Red bank new jersey newspaper. Available on microfilm from Micro Photo Div.
Red bank new jersey newspaper. In the third segment of this series, Monmouth County Clerk Christine Giordano Hanlon provides insight into the process of preserve historic photos from the now defunct Red Red Bank Register Archive The Red Bank Register, 1878-1964, and the Daily Register, 1964-1991. Red Bank-Shrewsbury, NJ local notices and open conversation posted by Patch readers Red Bank-Shrewsbury, NJ crime, fire and public safety news and events, police & fire department updates Newspaper online: Red Bank Register The Red Bank Register is online. A Red Bank resident filed a criminal complaint against Red Bank Green reporter and publisher to remove an article listing his arrest. . Discover the most extensive New Jersey newspaper and news media guide on the internet. William Elijah Rock, the publisher of The Echo— New Jersey's oldest Black-owned Newspaper. Aquí nos gustaría mostrarte una descripción, pero el sitio web que estás mirando no lo permite. An excellent source for resident information, news, important notices and community calendar. He served his country in the National Guard, specializing in tank recovery. Red Bank Register The Red Bank Register is a free online historical newspaper, covering Red Bank, New Jersey and surrounding areas in Monmouth County. Founded in September 1990, approved as an IRS 501(c)(3) nonprofit charity in February 2024 and donated to the community by Domenic DiPiero in Our digital collections include: The Courier Red Bank Register Middletown Veterans Our physical collections include: Courier Newspaper Bound Volumes (January 1959- April 2009) Same Situation, Different Outcome? Police Response Varies by Race in Viral Side-by-Side Video ------------- -------------------------------------- news now breaking today, happening right now browse over 20 Red Bank, New Jersey obituary indexes including newspaper obituaries, death indexes, funeral home obituaries. We are Daily (except Sat. 1968-present available on microfilm at the New Jersey State Library. 13,554 likes · 271 talking about this. Red Bank Daily Voice provides the latest community news written by award-winning editors and local reporters. Edition of The Daily Register Get this The Daily Register page for free from Monday, October 23, 1967 Lynn Angerole Married To Temple Alumnus RED BANK Miss Lynn rie Angerole, daughter of Mr. Red Bank New Jersey Newspaper Archives You can search through Red Bank, New Jersey newspapers for free! Browse through publications and see if we have the stories Must be on site or library cardholder for database access. Of Cooper Univ. Published by Thomas Echo News TV, LLC Community News & Opinion Articles New Jersey's oldest Black-owned newspaper circa 1904 Most Popular Local Kid From Asbury Park & Neptune Promoted To Medical Dir. See reviews, photos, directions, phone numbers and more for the best Newspapers in Red Bank, NJ. This is a tremendous resource for anyone with family in The inaugural Jersey’s Best 2022 Destination of the Year (Jersey Shore edition) will soon be announced; and though the fifth and last finalist to be revealed isn’t quite on This is a gift to Red Bank. TAPinto Red Bank is a local news and digital marketing platform for Red Bank, NJ, 07701. Available on microfilm from Micro Photo Div. Rahway Record (1913-1946): The Rahway Public Library Red Bank Register (1878–1991) Newspaper Archives: Middletown Township Public Library & Red Bank Public Search for all of today's most recent Red Bank Obituaries from Local Newspapers and Funeral Homes in Red Bank, New Jersey. ) Vol. Find photos and videos, comment on the news, and join the forum discussions at NJ. The following is Find links to New Jersey newspapers and news media. They Search Red Bank, New Jersey recent obituaries and death notices. ” Donohue, a 20-year borough resident, created “Ledger Live,” the forerunner to “Positively New Jersey,” while working as a reporter at the Star-Ledger, New Jersey’s largest newspaper, bringing a Article on controversy among Two River Times, weekly newspaper in Red Bank, NJ, owned by Geraldo Rivera, and competing weeklies The Hub and The Tri City News; New Jersey Digitized Historic Newspapers This guide indexes all known digitized newspapers published in New Jersey, including links and other access information. Get this The Daily Register page for free from Friday, June 27, 1969 THE DAILY REGISTER, RED BANK MIDDLETOWN, N. Send flowers, find service dates or offer condolences for the lives we have lost in Monmouth County, New Jersey. 3,726 likes · 25 talking about this. The crime and arrest reports below were provided by the Red Bank Police Get this The Daily Register page for free from Wednesday, July 10, 1968 4-THE DAILY REGISTER, Wednesday, July 10, 1968 Louise Lang Miller, 65, Fatally Injured by Auto RED Powered by the Tampa Bay Times, tampabay. 39 likes, 0 comments - gotcnj on September 3, 2025: "The day Atlantic Highlands, New Jersey, mourned someone who perfectly represented the dual personalities of mobsters. com. Hyperlocal news, alerts, discussions and events for Red Bank and Shrewsbury, NJ Subscribe Subscribe to The Two River Times, and get the newspaper conveniently delivered to your home weekly. , Bell & Howell Co. 6 (July 6, 1964)- Sunday edition called: Sunday register. Check out our voter guide before you hit the polls in Red Bank and Red Bank police officers at the swearing-in ceremony of Chief Mike Frazee on October 11, 2024. 87, no. Nestled along the picturesque banks of the Navesink River, downtown Red Bank stands as a vibrant and enchanting hub of cultural, culinary, and commercial activity. Red Bank is in the New New Jersey Public Notices This website is a compilation of public notices published throughout the state of New Jersey; as a public service made possible by the New Jersey Press Association. New Jersey State Department of Discover archival news from The Daily Register, Red Bank, New Jersey, United States. This easy-to-use website is designed to A graduate of Red Bank High School (Class of ’73), where Chuck was active in sports—playing softball and wrestling. Hyperlocal news and features coverage of Red Bank, New Jersey. See Health & Fitness Read About Area History Online in the 'Red Bank Register' Archives A joint project between local libraries has digitized old copies of the Red Bank These newspaper photographs were drawn from The Red Bank Register Negative Collection of the Monmouth County Archives. S. Police & Fire local news for Red Bank. Walker, Oct. Choose a search below Search Photo Collection Search Red Bank Register 1878 to 1969 Search Red Bank Register 1970 to 1991 Search City Directories, Historical Publication, Echo Express Jersey Shore area news from Monmouth and Ocean county communities and New Jersey news, from the Asbury Park Press The Red Bank Public Library is a free public library in Red Bank, New Jersey. 8,717 likes · 57 talking about this. The paper is published every Thursday. com, viewed May 26, 2020 Special Historical and Harvest sale supplement edited and compiled by Albert E. Read on News from Monmouth County communities including Asbury Park, Freehold, Howell, Long Branch, Manalapan, Middletown, Neptune, Red Bank. We provide materials, information, technology, and cultural opportunities to enrich, empower, educate, and entertain people of all ages and backgrounds. News from towns in the Red Bank-Middletown area in Monmouth County, NJ, from the Asbury Park Press The Two River Times. View local obituaries in Monmouth County, New Jersey. The available years are 1878-1991. Leave messages of comfort, send flowers or get service details for the ones you've lost. How to Search Red Bank, New Jersey Obituary Archives How do you begin searching through our vast Red Bank obituary archives? The easiest way to perform a basic Red Bank obituary Two West Nile Virus-Related Deaths Among Six New Cases Reported In New Jersey New Jersey health officials are reporting an additional six cases of West Nile Virus including two deaths, Title from masthead, newspapers. [Monmouth County] The Rockaway Township Library has digitized The Stay updated with the latest Red Bank, NJ local news, trending, crime map, sports, celebrity updates, stock market trends, and more. The Two River Times is a weekly newspaper about life in Monmouth County, NJ, sold by subscription an Welcome to Red Bank – where history meets charm, and community thrives along the scenic Navesink River! Nestled in the heart of Monmouth County, New Jersey, our vibrant borough RED BANK – What began as one mother’s quest for a thriving future for her son has turned into a groundbreaking moment for families across New Jersey. Monmouth County Digitized Newspapers Please note: The New Jersey State Library may not have access to any of the commercially accessible papers listed below. Welcome to the online digital collection of Red Bank Public Library Funding for digitization and access has been made possible in part by: A special projects grant from the New Jersey Historical Commission, a Division of the Red Bank-Shrewsbury Dogs Seek Feature On NJ Lottery Scratch-Offs The dogs are competing to be featured on scratch-off tickets through the NJ Lottery's "Jersey's Top Dogs" Contest. Monmouth County Archives Genealogy Research Guide New Jersey Center for Health Statistics - Public health data analysis. Learn More Red Bank-Shrewsbury Patch. Edition of The Daily Register Newspapers The biggest Newark papers are the Newark Daily Advertiser (19th century) the Newark News (also known as the Newark Evening News or Newark Sunday News, 1883-1972) and the Star Ledger (became the largest paper News and information about Red Bank, Fair Haven and Little Silver, New Jersey. Please Red Bank-Shrewsbury Voter Guide 2025: Who’s On Ballot, Where To Vote The primary election is Tuesday, June 10. New Jersey State Archives - Searchable databases for New Jersey. The Monmouth Journal is a digital news site serving the Two River area of Northern Monmouth County in New Jersey, including the towns of Red Bank, Middletown, Rumson, Fair Haven, Little Silver, Monmouth Beach, Sea RED BANK, NJ: Mayor Billy Portman opened the hybrid (online and in-person), council meeting last Read more » List of New Jersey newspapers for information on NJ state events, politics, business, jobs, weather, and travel Red Bank English Teacher Arrested for Sexual Assault, Endangering Welfare of a Child Red Bank 3 years ago Get the latest news from Monmouth County from The Star-Ledger, find Monmouth County real estate listings and talk about local news on NJ. Most of the negatives were donated in 2008 by Donald Bur View recent online obituaries and memorial websites for people from Red Bank, New Jersey. Edition of The triCityNews focuses on three small cities in coastal Monmouth County, New Jersey; Asbury Park, Long Branch and Red Bank. There’s an “other” Red Bank? Yes, that’s correct, but this “other” Red Bank has little in common with the thriving hub on the Jersey Shore that is rich with shopping, Red Bank Register and Daily Register Full text keyword searching and date access to the Red Bank Register from June 27, 1878 and as the Daily Register from 1964 until November 13, 1991 when publication ceased. com is your home for breaking news you can trust. Learn about deaths, get funeral information, share your own condolences and more. state of New Jersey. Red Bank Register 1878 1879 1880 1881 1882 1883 1884 1885 1886 1887 1888 1889 1890 1891 1892 1893 1894 1895 1896 1897 1898 1899 1900 1901 1902 1903 1904 1905 1906 1907 1908 About View Red Bank obituaries on Legacy, the most timely and comprehensive collection of local obituaries for Red Bank, New Jersey, updated regularly throughout the day Local news for Red Bank, covering local news, high school sports, police, fire, and local government issues for Red Bank, NJ, 07701. Online access is UK Police Arrest Pro-Palestine Protesters—Signs Opposing Genocide Cited as Offense ------------------- -------------------------------- news now breaking today, happening right now update, 2025 redbankgreen. com, drawing on traveler reviews from TripAdvisor. RED BANK, NJ: The Red Bank Farmer's Market offers a vibrant array of seasonal produce, artisanal Read more » Newspapers in Red Bank on YP. 1992-2011 available on microfilm at the Red Bank Public 1 2 3 378 Page 1 of 378There are currently no events. We promote the alternative throughout the area. Founded in September 1990, the TRT is a full broadsheet, paid circulation weekly newspaper based in Red Bank and covering towns on or near the Navesink and Shrewsbury Rivers in The Monmouth Journal is a digital news site serving the Two River area of Northern Monmouth County in New Jersey, including the towns of Red Bank, Middletown, Rumson, Fair Haven, The triCityNews focuses on three small cities in coastal Monmouth County, New Jersey; Asbury Park, Long Branch and Red Bank. The Daily Register was published in Red Bank, New Jersey and includes 356,180 searchable pages from 1878-1988. News from towns in the Red Bank-Middletown area in Monmouth County, NJ, from the Asbury Park Press Founded in September 1990, approved as an IRS 501 (c) (3) nonprofit charity in February 2024 and donated to the community by Domenic DiPiero in September 2024, the TRT is a full Welcome to The Two River Times. 4, 1911. The periodical did not renew copyrights for issues and issues are in the public domain that were The home page for Monmouth County and Ocean County, NJ: breaking and in-depth local news, sports, obituaries, databases, events, classifieds and more. Red Bank is a borough in Monmouth County, in the U. List of New Jersey newspapers for information on NJ state events, politics, business, jobs, weather, and travel Get this The Daily Register page for free from Wednesday, November 8, 1961 21 Wednesday, Nov. Our family felt the need to relaunch the publication Learn all about Red Bank's rich history including the Eisner family, The Red Bank Register Archive, and the history of the Galleria Building. Phone: (732) 219-5788 Email: USA (1,403,636) > New Jersey (19,298) > New Jersey Newspapers and Obituaries (2,059) > Monmouth County Newspapers and Obituaries (185) NOTE: Additional records that apply to New Jersey Newspapers on Microfilm The State Archives has acquired, through in-house production and donation, over 8,000 master negative reels of nearly 600 New Jersey Get New Jersey latest news. Browse or search for obituaries in the Red Bank, New Jersey - Ancestry® Hi, my name is Karen Brittingham-Edmond, the great-granddaughter of Mr. Across New Jersey, NJ | Breaking News | 3h Severe Storms, Possible Tornadoes In NJ Forecast Saturday: See Latest Timing A warm and humid Saturday will spawn severe weather later in the day. Incorporated in 1908, the community is on the Navesink River, the area's original transportation route to the ocean and other ports. The Daily Register is a daily newspaper based in Red Bank, New Jersey. Red Bank, New Jersey has been recognized as one of the most peaceful towns in the United States by TheTravel. Set us as your home page and never miss the news that matters to you. Explore The Daily Register online newspaper archive. com, Red Bank. Borough of Red Bank The official web site for the Borough of Red Bank, New Jersey. and Mrs. hibacbhlcvbpkkyfunoaiwvkqfdvdfiktlwrlyhyhtgtnnlkkt